Perlwapin, Recombinant, Haliotis Laevigata, aa1-134, His-Tag

Catalog No : USB-374668
1280.50€
0.00€

Shipping cost plus VAT not included , delivery in 7-14 business days

Product name Perlwapin, Recombinant, Haliotis Laevigata, aa1-134, His-Tag
Catalog No USB-374668
Supplier’s Catalog No 374668
Supplier US Biologicals
Source antigen Recombinant, Yeast
Reactivity
Cross reactivity
Applications
Molecular weight 16.5
Storage -20°C
Other names
Grade Highly Purified
Purity ~90% (SDS-PAGE)
Form Supplied as a liquid in Tris, 50% glycerol.
Reactivity life 6 months
Note For reserch purpose only
Purity ~90% (SDS-PAGE)
Description Inhibits growth of calcium carbonate crystals. May inhibit growth of certain crystallographic planes in the mineral phase of nacre in the shell. Source: Recombinant protein corresponding to aa1-134 from haliotis laevigata Perlwapin, fused to His-Tag at N-terminal, expressed in Yeast. Molecular Weight: ~16.5kD AA Sequence: YGPNLPGCPPGPYPRICARYCHSDRECKAGYYCCNTGCLNICVPKPKPGLCPAIRPGPCKGNVCSNDQDCPGNQKCCGKPGCRRCYRPEKPGSCPPRKYDAGVCVIYCVGDFDCPGNEKCCGSCPRRCEKPCFD Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.