Pburs, Recombinant, Drosophila Melanogaster, aa21-141, His-Tag (Partner of Bursicon)

Catalog No : USB-374629
1280.50€
0.00€

Shipping cost plus VAT not included , delivery in 7-14 business days

Product name Pburs, Recombinant, Drosophila Melanogaster, aa21-141, His-Tag (Partner of Bursicon)
Catalog No USB-374629
Supplier’s Catalog No 374629
Supplier US Biologicals
Source antigen Recombinant, Yeast
Reactivity
Cross reactivity
Applications
Molecular weight 15.8
Storage -20°C
Other names
Grade Highly Purified
Purity ~90% (SDS-PAGE)
Form Supplied as a liquid in Tris, 50% glycerol.
Reactivity life 6 months
Note For reserch purpose only
Purity ~90% (SDS-PAGE)
Description Final heterodimeric neurohormone released at the end of the molting cycle, involved in the sclerotization (tanning) of the insect cuticle, melanization and wing spreading. Heterodimer specifically activates the G protein-coupled receptor rk. Source: Recombinant protein corresponding to aa21-141 from drosophila melanogaster Partner of Bursicon, fused to His-Tag at N-terminal, expressed in Yeast. Molecular Weight: ~15.8kD AA Sequence: LRYSQGTGDENCETLKSEIHLIKEEFDELGRMQRTCNADVIVNKCEGLCNSQVQPSVITPTGFLKECYCCRESFLKEKVITLTHCYDPDGTRLTSPEMGSMDIRLREPTECKCFKCGDFTR Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.