Oxyopinin-4a, Recombinant, Oxyopes Takobius, aa48-77, His-SUMO-Tag
Catalog No : USB-374582
1189.69€
0.00€
Shipping cost plus VAT not included , delivery in 7-14 business days
| Product name | Oxyopinin-4a, Recombinant, Oxyopes Takobius, aa48-77, His-SUMO-Tag | ||
|---|---|---|---|
| Catalog No | USB-374582 | ||
| Supplier’s Catalog No | 374582 | ||
| Supplier | US Biologicals | ||
| Source antigen | Recombinant, E. coli | ||
| Reactivity | |||
| Cross reactivity | |||
| Applications | |||
| Molecular weight | 19.6 | ||
| Storage | -20°C | ||
|---|---|---|---|
| Other names | |||
| Grade | Highly Purified | ||
| Purity | ~90% (SDS-PAGE) | ||
| Form | Supplied as a liquid in Tris, 50% glycerol. | ||
| Reactivity life | 6 months | ||
| Note | For reserch purpose only | ||
| Purity | ~90% (SDS-PAGE) | ||
| Description | Disrupts cell membranes through the formation of pores (Probable). Has antibacterial activity against Gram-positive bacteria S.aureus (MIC=10uM) and B.subtilis (MIC=0.5uM) as well as Gram-negative bacteria P.fluorescens (MIC=1uM) and E.coli (MIC=0.5uM). Has hemolytic activity against human erythrocytes (EC(50)=7uM). Source: Recombinant protein corresponding to aa48-77 from oxyopes takobius Oxyopinin-4a, fused to His-SUMO-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~19.6kD AA Sequence: GIRCPKSWKCKAFKQRVLKRLLAMLRQHAF Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer. | ||
Product Details
© 2020 Imugex All Rights Reserved