Mup11, Recombinant, Mouse, aa1-151, His-Tag (Major Urinary Proteins 11 and 8)

Catalog No : USB-374323
1048.31€
0.00€

Shipping cost plus VAT not included , delivery in 7-14 business days

Product name Mup11, Recombinant, Mouse, aa1-151, His-Tag (Major Urinary Proteins 11 and 8)
Catalog No USB-374323
Supplier’s Catalog No 374323
Supplier US Biologicals
Source antigen Recombinant, E. coli
Reactivity
Cross reactivity
Applications
Molecular weight 21.6
Storage -20°C
Other names
Grade Highly Purified
Purity ~90% (SDS-PAGE)
Form Supplied as a liquid in Tris, 50% glycerol.
Reactivity life 6 months
Note For reserch purpose only
Purity ~90% (SDS-PAGE)
Description Binds pheromones that are released from drying urine of males. These pheromones affect the sexual behavior of fales. Source: Recombinant protein corresponding to aa1-151 from mouse Major Urinary Proteins 11 and 8, fused to His-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~21.6kD AA Sequence: REKINGEWHTIILASDKREKIEDNGNFRLFLEQIHVLENSLVLKFHTVRDEECSELSMVADKTEKAGEYSVTYDGFNTFTIPKTDYDNFLMAHLINEKDGETFQLMGLYGREPDLSSDIKERFAQLCEEHGILRENIIDLSNANRCLQARE Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.