MPZ, Recombinant, Human, aa30-156, His-Tag (Myelin Protein P0)

Catalog No : USB-374258
947.15€
0.00€

Shipping cost plus VAT not included , delivery in 7-14 business days

Product name MPZ, Recombinant, Human, aa30-156, His-Tag (Myelin Protein P0)
Catalog No USB-374258
Supplier’s Catalog No 374258
Supplier US Biologicals
Source antigen Recombinant, Yeast
Reactivity
Cross reactivity
Applications
Molecular weight
Storage -20°C
Other names
Grade Purified
Purity ~90% (SDS-PAGE)
Form Supplied as a liquid in Tris, 50% glycerol.
Reactivity life 6 months
Note For reserch purpose only
Purity ~90% (SDS-PAGE)
Description Creation of an Extracellular domain membrane face which guides the wrapping process and ultimately compacts adjacent lamellae. Source: Partial recombinant protein corresponding to aa30-156 from human MPZ, fused to His-Tag at N-terminal, expressed in Yeast. AA Sequence: IVVYTDREVHGAVGSRVTLHCSFWSSEWVSDDISFTWRYQPEGGRDAISIFHYAKGQPYIDEVGTFKERIQWVGDPRWKDGSIVIHNLDYSDNGTFTCDVKNPPDIVGKTSQVTLYVFEKVPTRYGV Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 6 months after receipt at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.