LY6G6D, Recombinant, Human, aa20-104, His-Tag (Lymphocyte Antigen 6 Complex Locus Protein G6d)

Catalog No : USB-374098
947.15€
0.00€

Shipping cost plus VAT not included , delivery in 7-14 business days

Product name LY6G6D, Recombinant, Human, aa20-104, His-Tag (Lymphocyte Antigen 6 Complex Locus Protein G6d)
Catalog No USB-374098
Supplier’s Catalog No 374098
Supplier US Biologicals
Source antigen Recombinant, Yeast
Reactivity
Cross reactivity
Applications
Molecular weight 12
Storage -20°C
Other names
Grade Purified
Purity ~85% (SDS-PAGE)
Form Supplied as a liquid in Tris, 50% glycerol.
Reactivity life 6 months
Note For reserch purpose only
Purity ~85% (SDS-PAGE)
Description Source: Recombinant protein corresponding to aa20-104 from human LY6G6D, fused to His-Tag at N-terminal, expressed in Yeast. Molecular Weight: ~12kD AA Sequence: NRMRCYNCGGSPSSSCKEAVTTCGEGRPQPGLEQIKLPGNPPVTLIHQHPACVAAHHCNQVETESVGDVTYPAHRDCYLGDLCNS Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 6 months after receipt at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.