LSM10, Recombinant, Human, aa1-123, His-SUMO-Tag (U7 snRNA-associated Sm-like Protein LSm10)
Catalog No : USB-374087
881.63€
0.00€
Shipping cost plus VAT not included , delivery in 7-14 business days
| Product name | LSM10, Recombinant, Human, aa1-123, His-SUMO-Tag (U7 snRNA-associated Sm-like Protein LSm10) | ||
|---|---|---|---|
| Catalog No | USB-374087 | ||
| Supplier’s Catalog No | 374087 | ||
| Supplier | US Biologicals | ||
| Source antigen | Recombinant, E. coli | ||
| Reactivity | |||
| Cross reactivity | |||
| Applications | |||
| Molecular weight | 30.1 | ||
| Storage | -20°C | ||
|---|---|---|---|
| Other names | |||
| Grade | Highly Purified | ||
| Purity | ~90% (SDS-PAGE) | ||
| Form | Supplied as a liquid in Tris, 50% glycerol. | ||
| Reactivity life | 6 months | ||
| Note | For reserch purpose only | ||
| Purity | ~90% (SDS-PAGE) | ||
| Description | Appears to function in the U7 snRNP complex that is involved in histone 3'-end processing. Increases U7 snRNA levels but not histone 3'-end pre-mRNA processing activity, when overexpressed. Required for cell cycle progression from G1 to S phases. Binds specifically to U7 snRNA. Binds to the downstream cleavage product (DCP) of histone pre-mRNA in a U7 snRNP dependent manner. Source: Recombinant protein corresponding to aa1-123 from human LSM10, fused to His-SUMO-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~30.1kD AA Sequence: MAVSHSVKERTISENSLIILLQGLQGRVTTVDLRDESVAHGRIDNVDAFMNIRLAKVTYTDRWGHQVKLDDLFVTGRNVRYVHIPDDVNITSTIEQQLQIIHRVRNFGGKGQGRWEFPPKNCK Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer. | ||
Product Details
© 2020 Imugex All Rights Reserved