LRBA, Recombinant, Human, aa1267-1500, His-Tag (Lipopolysaccharide-responsive and Beige-like Anchor Protein)

Catalog No : USB-374080
881.63€
0.00€

Shipping cost plus VAT not included , delivery in 7-14 business days

Product name LRBA, Recombinant, Human, aa1267-1500, His-Tag (Lipopolysaccharide-responsive and Beige-like Anchor Protein)
Catalog No USB-374080
Supplier’s Catalog No 374080
Supplier US Biologicals
Source antigen Recombinant, E. coli
Reactivity
Cross reactivity
Applications
Molecular weight 29.8
Storage -20°C
Other names
Grade Highly Purified
Purity ~90% (SDS-PAGE)
Form Supplied as a liquid in Tris, 50% glycerol.
Reactivity life 6 months
Note For reserch purpose only
Purity ~90% (SDS-PAGE)
Description May be involved in coupling signal transduction and vesicle trafficking to enable polarized secretion and/or membrane deposition of immune effector molecules. Source: Recombinant protein corresponding to aa1267-1500 from human LRBA, fused to His-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~29.8kD AA Sequence: PQPHRHVLEISRQHEQPGQGIAPDAVNGQRRDSRSTVFRIPEFNWSQMHQRLLTDLLFSIETDIQMWRSHSTKTVMDFVNSSDNVIFVHNTIHLISQVMDNMVMACGGILPLLSAATSATHELENIEPTQGLSIEASVTFLQRLISLVDVLIFASSLGFTEIEAEKSMSSGGILRQCLRLVCAVAVRNCLECQQHSQLKTRGDKALKPMHSLIPLGKSAAKSPVDIVTGGISPV Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.