LCR83, Recombinant, Arabidopsis Thaliana, aa28-82, GST-Tag (Putative Defensin-like Protein 70)

Catalog No : USB-373996
1280.50€
0.00€

Shipping cost plus VAT not included , delivery in 7-14 business days

Product name LCR83, Recombinant, Arabidopsis Thaliana, aa28-82, GST-Tag (Putative Defensin-like Protein 70)
Catalog No USB-373996
Supplier’s Catalog No 373996
Supplier US Biologicals
Source antigen Recombinant, Yeast
Reactivity
Cross reactivity
Applications
Molecular weight 32.9
Storage -20°C
Other names
Grade Highly Purified
Purity ~90% (SDS-PAGE)
Form Supplied as a liquid in Tris, 50% glycerol.
Reactivity life 6 months
Note For reserch purpose only
Purity ~90% (SDS-PAGE)
Description Source: Recombinant protein corresponding to aa28-82 from arabidopsis thaliana LCR83, fused to GST-Tag at N-terminal, expressed in Yeast. Molecular Weight: ~32.9kD AA Sequence: NFASGEASSQLCFNPCTPQLGNNECNTICMNKKYKEGSCVGFGIPPTSKYCCCKT Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.