Lcn5, Recombinant, Mouse, aa27-192, His-Tag (Epididymal-specific Lipocalin-5)
Catalog No : USB-373993
1048.31€
0.00€
Shipping cost plus VAT not included , delivery in 7-14 business days
| Product name | Lcn5, Recombinant, Mouse, aa27-192, His-Tag (Epididymal-specific Lipocalin-5) | ||
|---|---|---|---|
| Catalog No | USB-373993 | ||
| Supplier’s Catalog No | 373993 | ||
| Supplier | US Biologicals | ||
| Source antigen | Recombinant, E. coli | ||
| Reactivity | |||
| Cross reactivity | |||
| Applications | |||
| Molecular weight | 22.3 | ||
| Storage | -20°C | ||
|---|---|---|---|
| Other names | |||
| Grade | Highly Purified | ||
| Purity | ~90% (SDS-PAGE) | ||
| Form | Supplied as a liquid in Tris, 50% glycerol. | ||
| Reactivity life | 6 months | ||
| Note | For reserch purpose only | ||
| Purity | ~90% (SDS-PAGE) | ||
| Description | Associates with spermatozoa in the epididymal fluid but does not bind tightly to them. Binds both all-trans and 13-cis retinoic acid. May act as a retinoid carrier protein which is required for epididymal function and/or sperm maturation. Source: Recombinant protein corresponding to aa27-192 from mouse Lcn5, fused to His-Tag at N-terminal expressed in E. coli. Molecular Weight: ~22.3kD AA Sequence: TEAAVVKDFDVNKFLGFWYEIALASKMGAYGLAHKEEKMGAMVVELKENLLALTTTYYNEGHCVLEKVAATQVDGSAKYKVTRISGEKEVVVVATDYMTYTVIDITSLVAGAVHRAMKLYSRSLDNNGEALNNFQKIALKHGFSETDIHILKHDLTCVNALQSGQI Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer. | ||
Product Details
© 2020 Imugex All Rights Reserved