Kif1a, Recombinant, Mouse, aa1-361, His-SUMO-Tag (Kinesin-like Protein KIF1A)

Catalog No : USB-373917
1048.31€
0.00€

Shipping cost plus VAT not included , delivery in 7-14 business days

Product name Kif1a, Recombinant, Mouse, aa1-361, His-SUMO-Tag (Kinesin-like Protein KIF1A)
Catalog No USB-373917
Supplier’s Catalog No 373917
Supplier US Biologicals
Source antigen Recombinant, E. coli
Reactivity
Cross reactivity
Applications
Molecular weight 56.4
Storage -20°C
Other names
Grade Highly Purified
Purity ~90% (SDS-PAGE)
Form Supplied as a liquid in Tris, 50% glycerol.
Reactivity life 6 months
Note For reserch purpose only
Purity ~90% (SDS-PAGE)
Description Motor for anterograde axonal transport of synaptic vesicle precursors. Source: Recombinant protein corresponding to aa1-361 from mouse Kif1a, fused to His-SUMO-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~56.4kD AA Sequence: MAGASVKVAVRVRPFNSREMSRDSKCIIQMSGSTTTIVNPKQPKETPKSFSFDYSYWSHTSPEDINYASQKQVYRDIGEEMLQHAFEGYNVCIFAYGQTGAGKSYTMMGKQEKDQQGIIPQLCEDLFSRINDTTNDNMSYSVEVSYMEIYCERVRDLLNPKNKGNLRVREHPLLGPYVEDLSKLAVTSYNDIQDLMDSGNKPRTVAATNMNETSSRSHAVFNIIFTQKRHDAETNITTEKVSKISLVDLAGSERADSTGAKGTRLKEGANINKSLTTLGKVISALAEMDSGPNKNKKKKKTDFIPYRDSVLTWLLRENLGGNSRTAMVAALSPADINYDETLSTLRYADRAKQIRCNAIIN Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.