KCTD15, Recombinant, Human, aa1-234, GST-Tag (BTB/POZ Domain-containing protein KCTD15)

Catalog No : USB-373907
881.63€
0.00€

Shipping cost plus VAT not included , delivery in 7-14 business days

Product name KCTD15, Recombinant, Human, aa1-234, GST-Tag (BTB/POZ Domain-containing protein KCTD15)
Catalog No USB-373907
Supplier’s Catalog No 373907
Supplier US Biologicals
Source antigen Recombinant, E. coli
Reactivity
Cross reactivity
Applications
Molecular weight 53.5
Storage -20°C
Other names
Grade Purified
Purity ~90% (SDS-PAGE)
Form Supplied as a liquid in Tris, 50% glycerol.
Reactivity life 6 months
Note For reserch purpose only
Purity ~90% (SDS-PAGE)
Description During embryonic development, interferes with neural crest formation. Inhibits AP2 transcriptional activity by interaction with its activation domain. Source: Recombinant protein corresponding to aa1-234 from human KCTD15, fused to GST-Tag at N-terminal expressed in E. coli. Molecular Weight: ~53.5kD AA Sequence: MPHRKERPSGSSLHTHGSTGTAEGGNMSRLSLTRSPVSPLAAQGIPLPAQLTKSNAPVHIDVGGHMYTSSLATLTKYPDSRISRLFNGTEPIVLDSLKQHYFIDRDGEIFRYVLSFLRTSKLLLPDDFKDFSLLYEEARYYQLQPMVRELERWQQEQEQRRRSRACDCLVVRVTPDLGERIALSGEKALIEEVFPETGDVMCNSVNAGWNQDPTHVIRFPLNGYCRLNSVQDVL Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.