IL17A, Recombinant, Macaca Mulatta (Rhesus Macaque), aa24-155, GST-Tag (Uncharacterized Protein)

Catalog No : USB-373793
1132.22€
0.00€

Shipping cost plus VAT not included , delivery in 7-14 business days

Product name IL17A, Recombinant, Macaca Mulatta (Rhesus Macaque), aa24-155, GST-Tag (Uncharacterized Protein)
Catalog No USB-373793
Supplier’s Catalog No 373793
Supplier US Biologicals
Source antigen Recombinant, E. coli
Reactivity
Cross reactivity
Applications
Molecular weight 42.1
Storage -20°C
Other names
Grade Purified
Purity ~90% (SDS-PAGE)
Form Supplied as a liquid in Tris, 50% glycerol.
Reactivity life 6 months
Note For reserch purpose only
Purity ~90% (SDS-PAGE)
Description Source: Recombinant protein corresponding to aa24-155 from Macaca Mulatta (Rhesus Macaque) IL17A, fused to GST-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~42.1kD AA Sequence: GIAIPRNPGCPNSEDKTFPRTVMVNLNIHNRNTNTNPKRSSDYYNRSTSPWNLHRNEDPERYPSVIWEAKCRHLGCVNADGNVDYHMNSVPIQQEILVLRREPRHCPNSFRLEKILVSVGCTCVTPIVHHVA Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.