Ice-structuring Protein Lambda OP-3, Recombinant, Zoarces americanus, aa23-91, His-Tag (ISP lambda OP-3)

Catalog No : USB-373723
1189.69€
0.00€

Shipping cost plus VAT not included , delivery in 7-14 business days

Product name Ice-structuring Protein Lambda OP-3, Recombinant, Zoarces americanus, aa23-91, His-Tag (ISP lambda OP-3)
Catalog No USB-373723
Supplier’s Catalog No 373723
Supplier US Biologicals
Source antigen Recombinant, E. coli
Reactivity
Cross reactivity
Applications
Molecular weight 11.6
Storage -20°C
Other names
Grade Highly Purified
Purity ~90% (SDS-PAGE)
Form Supplied as a liquid in Tris, 50% glycerol.
Reactivity life 6 months
Note For reserch purpose only
Purity ~90% (SDS-PAGE)
Description Contributes to protect fish blood from freezing at subzero sea water temperatures. Lowers the blood freezing point. Binds to nascent ice crystals and prevents further growth (By similarity). Source: Recombinant protein corresponding to aa23-91 from zoarces americanus Ice-structuring protein lambda OP-3, fused to His-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~11.6kD AA Sequence: NQSVVATQLIPINTALTLVMMTTRVIYPTGIPAEDIPRLVSMQVNQAVPMGTTLMPDMVKFYCLCAPKN Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.