Hydrophobin, Recombinant, Neosartorya fumigata, aa19-159, His-Tag (RodA)
Catalog No : USB-373714
1280.50€
0.00€
Shipping cost plus VAT not included , delivery in 7-14 business days
| Product name | Hydrophobin, Recombinant, Neosartorya fumigata, aa19-159, His-Tag (RodA) | ||
|---|---|---|---|
| Catalog No | USB-373714 | ||
| Supplier’s Catalog No | 373714 | ||
| Supplier | US Biologicals | ||
| Source antigen | Recombinant, Yeast | ||
| Reactivity | |||
| Cross reactivity | |||
| Applications | |||
| Molecular weight | 16.3 | ||
| Storage | -20°C | ||
|---|---|---|---|
| Other names | |||
| Grade | Highly Purified | ||
| Purity | ~90% (SDS-PAGE) | ||
| Form | Supplied as a liquid in Tris, 50% glycerol. | ||
| Reactivity life | 6 months | ||
| Note | For reserch purpose only | ||
| Purity | ~90% (SDS-PAGE) | ||
| Description | Cell wall protein regularly arranged in interwoven fascicules of clustered proteinaceous microfibrils, or rodlets, to form the outer spore coat protein. It is involved in resistance to environmental stress and may well be associated with conidial hydrophobicity. It is important in the morphogenesis of the dispersible conidia. Source: Recombinant protein corresponding to aa19-159 from neosartorya fumigata rodA, fused to His-Tag at N-terminal, expressed in Yeast. Molecular Weight: ~16.3kD AA Sequence: LPQHDVNAAGNGVGNKGNANVRFPVPDDITVKQATEKCGDQAQLSCCNKATYAGDVTDIDEGILAGTLKNLIGGGSGTEGLGLFNQCSKLDLQIPVIGIPIQALVNQKCKQNIACCQNSPSDASGSLIGLGLPCIALGSIL Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer. | ||
Product Details
© 2020 Imugex All Rights Reserved