Hydrophobin-1, Recombinant, Hypocrea Jecorina, aa23-97, His-SUMO-Tag (Hfb1)
Catalog No : USB-373713
1189.69€
0.00€
Shipping cost plus VAT not included , delivery in 7-14 business days
| Product name | Hydrophobin-1, Recombinant, Hypocrea Jecorina, aa23-97, His-SUMO-Tag (Hfb1) | ||
|---|---|---|---|
| Catalog No | USB-373713 | ||
| Supplier’s Catalog No | 373713 | ||
| Supplier | US Biologicals | ||
| Source antigen | Recombinant, E. coli | ||
| Reactivity | |||
| Cross reactivity | |||
| Applications | |||
| Molecular weight | 23.5 | ||
| Storage | -20°C | ||
|---|---|---|---|
| Other names | |||
| Grade | Highly Purified | ||
| Purity | ~90% (SDS-PAGE) | ||
| Form | Supplied as a liquid in Tris, 50% glycerol. | ||
| Reactivity life | 6 months | ||
| Note | For reserch purpose only | ||
| Purity | ~90% (SDS-PAGE) | ||
| Description | Contributes to surface hydrophobicity, which is important for processes such as association of hyphae in reproductive structures, dispersal of aerial spores and adhesion of pathogens to host structures. Source: Recombinant protein corresponding to aa23-97 from hydrocrea jecorina hfb1, fused to His-SUMO-Tag at N-terminal expressed in E. coli. Molecular Weight: ~23.5kD AA Sequence: SNGNGNVCPPGLFSNPQCCATQVLGLIGLDCKVPSQNVYDGTDFRNVCAKTGAQPLCCVAPVAGQALLCQTAVGA Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer. | ||
Product Details
© 2020 Imugex All Rights Reserved