Guca2b, Recombinant, Mouse, aa22-106, His-Tag (Guanylate Cyclase Activator 2B)
Catalog No : USB-373563
1047.16€
0.00€
Shipping cost plus VAT not included , delivery in 7-14 business days
| Product name | Guca2b, Recombinant, Mouse, aa22-106, His-Tag (Guanylate Cyclase Activator 2B) | ||
|---|---|---|---|
| Catalog No | USB-373563 | ||
| Supplier’s Catalog No | 373563 | ||
| Supplier | US Biologicals | ||
| Source antigen | Recombinant, Yeast | ||
| Reactivity | |||
| Cross reactivity | |||
| Applications | |||
| Molecular weight | 11.4 | ||
| Storage | -20°C | ||
|---|---|---|---|
| Other names | |||
| Grade | Purified | ||
| Purity | ~85% (SDS-PAGE) | ||
| Form | Supplied as a liquid in Tris, 50% glycerol. | ||
| Reactivity life | 6 months | ||
| Note | For reserch purpose only | ||
| Purity | ~85% (SDS-PAGE) | ||
| Description | Endogenous activator of intestinal guanylate cyclase. It stimulates this enzyme through the same receptor binding region as the heat-stable enterotoxins. May be a potent physiological regulator of intestinal fluid and electrolyte transport. May be an autocrine/paracrine regulator of intestinal salt and water transport. Source: Recombinant protein corresponding to aa22-106 from mouse Guca2b, fused to His-Tag at N-terminal, expressed in Yeast. Molecular Weight: ~11.4kD AA Sequence: VYIKYHGFQVQLESVKKLNELEEKEMSNPQPRRSGLLPAVCHNPALPLDLQPVCASQEAASTFKALRTIATDECELCINVACTGC Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer. | ||
Product Details
© 2020 Imugex All Rights Reserved