GSP1, Recombinant, Saccharomyces Cerevisiae, aa2-219, His-SUMO-Tag (GTP-binding Nuclear Protein GSP1/CNR1)

Catalog No : USB-373538
1189.69€
0.00€

Shipping cost plus VAT not included , delivery in 7-14 business days

Product name GSP1, Recombinant, Saccharomyces Cerevisiae, aa2-219, His-SUMO-Tag (GTP-binding Nuclear Protein GSP1/CNR1)
Catalog No USB-373538
Supplier’s Catalog No 373538
Supplier US Biologicals
Source antigen Recombinant, E. coli
Reactivity
Cross reactivity
Applications
Molecular weight 40.7
Storage -20°C
Other names
Grade Highly Purified
Purity ~90% (SDS-PAGE)
Form Supplied as a liquid in Tris, 50% glycerol.
Reactivity life 6 months
Note For reserch purpose only
Purity ~90% (SDS-PAGE)
Description GTP-binding protein involved in nucleocytoplasmic domain transport. Required for the import of protein into the nucleus and also for RNA export. Essential for cell viability. By analogy with Ras, Ran may be activated when GTP is exchanged for bound GDP by RCC1 and inactivated when GTP is hydrolyzed by Ran upon activation by RanGAP1. Source: Recombinant protein corresponding to aa2-219 from saccharomyces cerevisiae GSP1, fused to His-SUMO-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~40.7kD AA Sequence: SAPAANGEVPTFKLVLVGDGGTGKTTFVKRHLTGEFEKKYIATIGVEVHPLSFYTNFGEIKFDVWDTAGQEKFGGLRDGYYINAQCAIIMFDVTSRITYKNVPNWHRDLVRVCENIPIVLCGNKVDVKERKVKAKTITFHRKKNLQYYDISAKSNYNFEKPFLWLARKLAGNPQLEFVASPALAPPEVQVDEQLMQQYQQEMEQATALPLPDEDDADL Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.