GPC, Recombinant, Lymphocytic Choriomeningitis Virus, aa10-90, His-SUMO-Tag (Pre-Glycoprotein Polyprotein GP Complex)
Catalog No : USB-373507
1033.36€
0.00€
Shipping cost plus VAT not included , delivery in 7-14 business days
| Product name | GPC, Recombinant, Lymphocytic Choriomeningitis Virus, aa10-90, His-SUMO-Tag (Pre-Glycoprotein Polyprotein GP Complex) | ||
|---|---|---|---|
| Catalog No | USB-373507 | ||
| Supplier’s Catalog No | 373507 | ||
| Supplier | US Biologicals | ||
| Source antigen | Recombinant, E. coli | ||
| Reactivity | |||
| Cross reactivity | |||
| Applications | |||
| Molecular weight | 24.9 | ||
| Storage | -20°C | ||
|---|---|---|---|
| Other names | |||
| Grade | Purified | ||
| Purity | ~90% (SDS-PAGE) | ||
| Form | Supplied as a liquid in Tris, 50% glycerol. | ||
| Reactivity life | 6 months | ||
| Note | For reserch purpose only | ||
| Purity | ~90% (SDS-PAGE) | ||
| Description | Stable signal peptide (SSP) is cleaved but is apparently retained as the third component of the GP complex. The SSP is required for efficient glycoprotein expression, post-translational cleavage of GP1 and GP2, glycoprotein transport to the cell plasma membrane, formation of infectious virus particles, and acid pH-dependent glycoprotein-mediated cell fusion. Source: Recombinant protein corresponding to aa10-90 from lymphocytic choriomeningitis virus Pre-Glycoprotein Polyprotein GP Complex, fused to His-SUMO-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~24.9kD AA Sequence: ALPHIIDEVINIVIIVLIVITGIKAVYNFATCGIFALISFLLLAGRSCGMYGLKGPDIYKGVYQFKSVEFDMSHLNLTMPN Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer. | ||
Product Details
© 2020 Imugex All Rights Reserved