Gingipain R2, Recombinant, Porphyromonas Gingivalis, aa230-473, His-SUMO-Tag (RgpB)

Catalog No : USB-373435
1041.64€
0.00€

Shipping cost plus VAT not included , delivery in 7-14 business days

Product name Gingipain R2, Recombinant, Porphyromonas Gingivalis, aa230-473, His-SUMO-Tag (RgpB)
Catalog No USB-373435
Supplier’s Catalog No 373435
Supplier US Biologicals
Source antigen Recombinant, E. coli
Reactivity
Cross reactivity
Applications
Molecular weight 43.3
Storage -20°C
Other names
Grade Purified
Purity ~90% (SDS-PAGE)
Form Supplied as a liquid in Tris, 50% glycerol.
Reactivity life 6 months
Note For reserch purpose only
Purity ~90% (SDS-PAGE)
Description Thiol protease which is believed to participate in intracellular degradation and turnover of proteins. Its proteolytic activity is a major factor in both periodontal tissue destruction and in bacterial host defense mechanisms. Activates complement C3 and C5. Source: Recombinant protein corresponding to aa230-473 from porphyromonas gingivalis Gingipain R2, fused to His-SUMO-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~43.3kD AA Sequence: YTPVEEKENGRMIVIVPKKYEEDIEDFVDWKNQRGLRTEVKVAEDIASPVTANAIQQFVKQEYEKEGNDLTYVLLVGDHKDIPAKITPGIKSDQVYGQIVGNDHYNEVFIGRFSCESKEDLKTQIDRTIHYERNITTEDKWLGQALCIASAEGGPSADNGESDIQHENIIANLLTQYGYTKIIKCYDPGVTPKNIIDAFNGGISLANYTGHGSETAWGTSHFGTTHVKQLTNSNQLPFIFDVAC Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.