Gingipain R2, Recombinant, Porphyromonas Gingivalis, aa230-473, His-SUMO-Tag (RgpB)
Catalog No : USB-373435
1041.64€
0.00€
Shipping cost plus VAT not included , delivery in 7-14 business days
| Product name | Gingipain R2, Recombinant, Porphyromonas Gingivalis, aa230-473, His-SUMO-Tag (RgpB) | ||
|---|---|---|---|
| Catalog No | USB-373435 | ||
| Supplier’s Catalog No | 373435 | ||
| Supplier | US Biologicals | ||
| Source antigen | Recombinant, E. coli | ||
| Reactivity | |||
| Cross reactivity | |||
| Applications | |||
| Molecular weight | 43.3 | ||
| Storage | -20°C | ||
|---|---|---|---|
| Other names | |||
| Grade | Purified | ||
| Purity | ~90% (SDS-PAGE) | ||
| Form | Supplied as a liquid in Tris, 50% glycerol. | ||
| Reactivity life | 6 months | ||
| Note | For reserch purpose only | ||
| Purity | ~90% (SDS-PAGE) | ||
| Description | Thiol protease which is believed to participate in intracellular degradation and turnover of proteins. Its proteolytic activity is a major factor in both periodontal tissue destruction and in bacterial host defense mechanisms. Activates complement C3 and C5. Source: Recombinant protein corresponding to aa230-473 from porphyromonas gingivalis Gingipain R2, fused to His-SUMO-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~43.3kD AA Sequence: YTPVEEKENGRMIVIVPKKYEEDIEDFVDWKNQRGLRTEVKVAEDIASPVTANAIQQFVKQEYEKEGNDLTYVLLVGDHKDIPAKITPGIKSDQVYGQIVGNDHYNEVFIGRFSCESKEDLKTQIDRTIHYERNITTEDKWLGQALCIASAEGGPSADNGESDIQHENIIANLLTQYGYTKIIKCYDPGVTPKNIIDAFNGGISLANYTGHGSETAWGTSHFGTTHVKQLTNSNQLPFIFDVAC Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer. | ||
Product Details
© 2020 Imugex All Rights Reserved