Foldase Protein PrsA, Recombinant, Staphylococcus Aureus, aa21-320, His-SUMO-Tag (PrsA)

Catalog No : USB-373358
1189.69€
0.00€

Shipping cost plus VAT not included , delivery in 7-14 business days

Product name Foldase Protein PrsA, Recombinant, Staphylococcus Aureus, aa21-320, His-SUMO-Tag (PrsA)
Catalog No USB-373358
Supplier’s Catalog No 373358
Supplier US Biologicals
Source antigen Recombinant, E. coli
Reactivity
Cross reactivity
Applications
Molecular weight 49.6
Storage -20°C
Other names
Grade Highly Purified
Purity ~90% (SDS-PAGE)
Form Supplied as a liquid in Tris, 50% glycerol.
Reactivity life 6 months
Note For reserch purpose only
Purity ~90% (SDS-PAGE)
Description Plays a major role in protein secretion by helping the post-translocational Extracellular domain folding of several secreted proteins. Source: Recombinant protein corresponding to aa21-320 from staphylococcus aureus Foldase Protein PrsA, fused to His-SUMO-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~49.6kD AA Sequence: CGASATDSKENTLISSKAGDVTVADTMKKIGKDQIANASFTEMLNKILADKYKNKVNDKKIDEQIEKMQKQYGGKDKFEKALQQQGLTADKYKENLRTAAYHKELLSDKIKISDSEIKEDSKKASHILIKVKSKKSDKEGLDDKEAKQKAEEIQKEVSKDPSKFGEIAKKESMDTGSAKKDGELGYVLKGQTDKDFEKALFKLKDGEVSEVVKSSFGYHIIKADKPTDFNSEKQSLKEKLVDQKVQKNPKLLTDAYKDLLKEYDVDFKDRDIKSVVEDKILNPEKLKQGGAQGGQSGMSQ Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.