Esm1, Recombinant, Mouse, aa22-184, His-SUMO-Tag (Endothelial Cell-specific Molecule 1)

Catalog No : USB-373223
1048.31€
0.00€

Shipping cost plus VAT not included , delivery in 7-14 business days

Product name Esm1, Recombinant, Mouse, aa22-184, His-SUMO-Tag (Endothelial Cell-specific Molecule 1)
Catalog No USB-373223
Supplier’s Catalog No 373223
Supplier US Biologicals
Source antigen Recombinant, E. coli
Reactivity
Cross reactivity
Applications
Molecular weight 33.7
Storage -20°C
Other names
Grade Highly Purified
Purity ~90% (SDS-PAGE)
Form Supplied as a liquid in Tris, 50% glycerol.
Reactivity life 6 months
Note For reserch purpose only
Purity ~90% (SDS-PAGE)
Description Involved in angiogenesis; promotes angiogenic sprouting. May have potent implications in lung endothelial cell-leukocyte interactions. Source: Recombinant protein corresponding to aa22-184 from mouse Esm1, fused to His-SUMO-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~33.7kD AA Sequence: AKYAVDCPEHCDKTECRSSLRCKRTVLDDCGCCQVCAAGPGETCYRTVSGMDGVKCGPGLKCHFYSEEDDFGDEFGICKDCPYGTFGMECKETCNCQSGICDRVTGRCLDFPFFQYAAAKSPSRTSASHTERDSASGDGNAVREEIGEGNAARPSVMKWLNPR Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.