DNA-binding Protein 7d, Recombinant, Sulfolobus Solfataricus, aa2-64, His-Tag (Sso7d)

Catalog No : USB-373076
1280.50€
0.00€

Shipping cost plus VAT not included , delivery in 7-14 business days

Product name DNA-binding Protein 7d, Recombinant, Sulfolobus Solfataricus, aa2-64, His-Tag (Sso7d)
Catalog No USB-373076
Supplier’s Catalog No 373076
Supplier US Biologicals
Source antigen Recombinant, Yeast
Reactivity
Cross reactivity
Applications
Molecular weight 9.1
Storage -20°C
Other names
Grade Highly Purified
Purity ~90% (SDS-PAGE)
Form Supplied as a liquid in Tris, 50% glycerol.
Reactivity life 6 months
Note For reserch purpose only
Purity ~90% (SDS-PAGE)
Description Constrain negative DNA supercoils; may be involved in maintaining the integrity of their genome at high temperature. Stimulates the Holliday junction cleavage activity of Hjc. Source: Recombinant protein corresponding to aa2-64 from sulfolobus solfataricus sso7d, fused to His-Tag at N-terminal, expressed in Yeast. Molecular Weight: ~9.1kD AA Sequence: ATVKFKYKGEEKEVDISKIKKVWRVGKMISFTYDEGGGKTGRGAVSEKDAPKELLQMLEKQKK Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.