DegP, Recombinant, E. coli, aa27-474, His-Tag (Periplasmic Serine Endoprotease DegP)
Catalog No : USB-373034
1280.50€
0.00€
Shipping cost plus VAT not included , delivery in 7-14 business days
| Product name | DegP, Recombinant, E. coli, aa27-474, His-Tag (Periplasmic Serine Endoprotease DegP) | ||
|---|---|---|---|
| Catalog No | USB-373034 | ||
| Supplier’s Catalog No | 373034 | ||
| Supplier | US Biologicals | ||
| Source antigen | Recombinant, Yeast | ||
| Reactivity | |||
| Cross reactivity | |||
| Applications | |||
| Molecular weight | 48.8 | ||
| Storage | -20°C | ||
|---|---|---|---|
| Other names | |||
| Grade | Highly Purified | ||
| Purity | ~90% (SDS-PAGE) | ||
| Form | Supplied as a liquid in Tris, 50% glycerol. | ||
| Reactivity life | 6 months | ||
| Note | For reserch purpose only | ||
| Purity | ~90% (SDS-PAGE) | ||
| Description | DegP acts as a chaperone at low temperatures but switches to a peptidase (heat shock protein) at higher temperatures. It degrades transiently denatured and unfolded proteins which accumulate in the periplasm following heat shock or other stress conditions. DegP is efficient with Val-Xaa and Ile-Xaa peptide bonds, suggesting a preference for beta-branched side chain amino acids. Only unfolded proteins devoid of disulfide bonds appear capable of being cleaved, thereby preventing non-specific proteolysis of folded proteins. Its proteolytic activity is essential for the survival of cells at elevated temperatures. It can degrade IciA, ada, casein, globin and PapA. DegP shares specificity with DegQ. DegP is also involved in the biogenesis of partially folded outer-membrane proteins (OMP). Source: Recombinant protein corresponding to aa27-474 from E. coli degP, fused to His-Tag at N-terminal, expressed in Yeast. Molecular Weight: ~48.8kD AA Sequence: AETSSATTAQQMPSLAPMLEKVMPSVVSINVEGSTTVNTPRMPRNFQQFFGDDSPFCQEGSPFQSSPFCQGGQGGNGGGQQQKFMALGSGVIIDADKGYVVTNNHVVDNATVIKVQLSDGRKFDAKMVGKDPRSDIALIQIQNPKNLTAIKMADSDALRVGDYTVAIGNPFGLGETVTSGIVSALGRSGLNAENYENFIQTDAAINRGNSGGALVNLNGELIGINTAILAPDGGNIGIGFAIPSNMVKNLTSQMVEYGQVKRGELGIMGTELNSELAKAMKVDAQRGAFVSQVLPNSSAAKAGIKAGDVITSLNGKPISSFAALRAQVGTMPVGSKLTLGLLRDGKQVNVNLELQQSSQNQVDSSSIFNGIEGAEMSNKGKDQGVVVNNVKTGTPAAQIGLKKGDVIIGANQQAVKNIAELRKVLDSKPSVLALNIQRGDSTIYLLMQ Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer. | ||
© 2020 Imugex All Rights Reserved