CM1, Recombinant, Arabidopsis Thaliana, aa3-247, His-Tag (Chorismate Mutase, Chloroplastic)

Catalog No : USB-372797
1189.69€
0.00€

Shipping cost plus VAT not included , delivery in 7-14 business days

Product name CM1, Recombinant, Arabidopsis Thaliana, aa3-247, His-Tag (Chorismate Mutase, Chloroplastic)
Catalog No USB-372797
Supplier’s Catalog No 372797
Supplier US Biologicals
Source antigen Recombinant, E. coli
Reactivity
Cross reactivity
Applications
Molecular weight 31.1
Storage -20°C
Other names
Grade Highly Purified
Purity ~90% (SDS-PAGE)
Form Supplied as a liquid in Tris, 50% glycerol.
Reactivity life 6 months
Note For reserch purpose only
Purity ~90% (SDS-PAGE)
Description May play a role in chloroplast biogenesis. Curated. Source: Recombinant protein corresponding to aa3-247 from arabidopsis thaliana Chorismate Mutase, Chloroplastic, fused to His-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~31.1kD AA Sequence: ASLLMRSSCCSSAIGGFFDHRRELSTSTPISTLLPLPSTKSSFSVRCSLPQPSKPRSGTSSVHAVMTLAGSLTGKKRVDESESLTLEGIRNSLIRQEDSIIFGLLERAKYCYNADTYDPTAFDMDGFNGSLVEYMVKGTEKLHAKVGRFKSPDEHPFFPDDLPEPMLPPLQYPKVLHFAADSININKKIWNMYFRDLVPRLVKKGDDGNYGSTAVCDAICLQCLSKRIHYGKFVAEAKFQASPEA Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.