CLDN3, Recombinant, Human, aa30-80, His-B2M-Tag (Claudin-3)

Catalog No : USB-372780
911.52€
0.00€

Shipping cost plus VAT not included , delivery in 7-14 business days

Product name CLDN3, Recombinant, Human, aa30-80, His-B2M-Tag (Claudin-3)
Catalog No USB-372780
Supplier’s Catalog No 372780
Supplier US Biologicals
Source antigen Recombinant, E. coli
Reactivity
Cross reactivity
Applications
Molecular weight 19.7
Storage -20°C
Other names
Grade Purified
Purity ~90% (SDS-PAGE)
Form Supplied as a liquid in Tris, 50% glycerol.
Reactivity life 6 months
Note For reserch purpose only
Purity ~90% (SDS-PAGE)
Description Plays a major role in tight junction-specific obliteration of the intercellular space, through calcium-independent cell-adhesion activity. Source: Recombinant protein corresponding to aa30-80 from human CLDN3, fused to His-B2M-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~19.7kD AA Sequence: RVSAFIGSNIITSQNIWEGLWMNCVVQSTGQMQCKVYDSLLALPQDLQAAR Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.