CD163, Recombinant, Mouse, aa86-365, His-Tag (Scavenger Receptor Cysteine-rich Type 1 Protein M130)
Catalog No : USB-372654
1048.31€
0.00€
Shipping cost plus VAT not included , delivery in 7-14 business days
| Product name | CD163, Recombinant, Mouse, aa86-365, His-Tag (Scavenger Receptor Cysteine-rich Type 1 Protein M130) | ||
|---|---|---|---|
| Catalog No | USB-372654 | ||
| Supplier’s Catalog No | 372654 | ||
| Supplier | US Biologicals | ||
| Source antigen | Recombinant, E. coli | ||
| Reactivity | |||
| Cross reactivity | |||
| Applications | |||
| Molecular weight | 34.2 | ||
| Storage | -20°C | ||
|---|---|---|---|
| Other names | |||
| Grade | Highly Purified | ||
| Purity | ~90% (SDS-PAGE) | ||
| Form | Supplied as a liquid in Tris, 50% glycerol. | ||
| Reactivity life | 6 months | ||
| Note | For reserch purpose only | ||
| Purity | ~90% (SDS-PAGE) | ||
| Description | Involved in clearance and endocytosis of hoglobin/haptoglobin complexes by macrophages and may thereby protect tissues from free hoglobin-mediated oxidative damage. May play a role in the uptake and recycling of iron, via endocytosis of hoglobin/haptoglobin and subsequent breakdown of he. Binds hoglobin/haptoglobin complexes in a calcium-dependent and pH-dependent manner. Induces a cascade of intracellular signals that involves tyrosine kinase-dependent calcium mobilization, inositol triphosphate production and secretion of IL6 and CSF1. After shedding, the soluble form (sCD163) may play an anti-inflammatory role. Source: Recombinant protein corresponding to aa86-365 from mouse Cd163, fused to His-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~34.2kD AA Sequence: VVCQQLGCPTSIKALGWANSSAGSGYIWMDKVSCTGNESALWDCKHDGWGKHNCTHEKDAGVTCSDGSNLEMRLVNSAGHRCLGRVEIKFQGKWGTVCDDNFSKDHASVICKQLGCGSAISFSGSAKLGAGSGPIWLDDLACNGNESALWDCKHRGWGKHNCDHAEDVGVICLEGADLSLRLVDGVSRCSGRLEVRFQGEWGTVCDDNWDLRDASVVCKQLGCPTAISAIGRVNASEGSGQIWLDNISCEGHEATLWECKHQEWGKHYCHHREDAGVTCS Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer. | ||
Product Details
© 2020 Imugex All Rights Reserved