CCDC3, Recombinant, Human, aa22-270, His-Tag (Coiled-coil Domain-containing Protein 3)

Catalog No : USB-372614
881.63€
0.00€

Shipping cost plus VAT not included , delivery in 7-14 business days

Product name CCDC3, Recombinant, Human, aa22-270, His-Tag (Coiled-coil Domain-containing Protein 3)
Catalog No USB-372614
Supplier’s Catalog No 372614
Supplier US Biologicals
Source antigen Recombinant, E. coli
Reactivity
Cross reactivity
Applications
Molecular weight 32.1
Storage -20°C
Other names
Grade Purified
Purity ~90% (SDS-PAGE)
Form Supplied as a liquid in Tris, 50% glycerol.
Reactivity life 6 months
Note For reserch purpose only
Purity ~90% (SDS-PAGE)
Description Source: Recombinant protein corresponding to aa22-270 from human CCDC3, fused to His-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~32.1kD AA Sequence: CQLPSEWRPLSEGCRAELAETIVYARVLALHPEAPGLYNHLPWQYHAGQGGLFYSAEVEMLCDQAWGSMLEVPAGSRLNLTGLGYFSCHSHTVVQDYSYFFFLRMDENYNLLPHGVNFQDAIFPDTQENRRMFSSLFQFSNCSQGQQLATFSSDWEIQEDSRLMCSSVQKALFEEEDHVKKLQQKVATLEKRNRQLRERVKKVKRSLRQARKKGRHLELANQKLSEKLAAGALPHINARGPVRPPYLRG Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.